RG33 TFA
Referentie T83757-1mg
Formaat : 1mg
Merk : TargetMol
RG33 TFA
Copy Product InfoRG33, a synthetic 33-amino acid peptide, matches the sequence of amino acids 209-219 and 220-241 found in the C-terminal domain class Y helices of apolipoprotein A1 (ApoA1). This compound has the ability to solubilize multilamellar vesicles (MLVs) containing 1,2-dimyristoyl-sn-glycero-3-PC (DMPC), resulting in the formation of recombinant HDL. When bound to lipids, RG33 facilitates cholesterol efflux in J774 macrophages and has been shown to reduce blood glucose levels in insulin-resistant mice at a dosage of 12 mg/kg.
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | RG33, a synthetic 33-amino acid peptide, matches the sequence of amino acids 209-219 and 220-241 found in the C-terminal domain class Y helices of apolipoprotein A1 (ApoA1). This compound has the ability to solubilize multilamellar vesicles (MLVs) containing 1,2-dimyristoyl-sn-glycero-3-PC (DMPC), resulting in the formation of recombinant HDL. When bound to lipids, RG33 facilitates cholesterol efflux in J774 macrophages and has been shown to reduce blood glucose levels in insulin-resistant mice at a dosage of 12 mg/kg. |
| Molecular Weight | 3790.36 |
| Formula | C175H282N42O51.XCF3COOH |
| Smiles | NC([C@H](CC(N)=O)NC([C@H](CC(C)C)NC([C@H](CCCCN)NC([C@H](CCCCN)NC([C@@]([C@@H](C)O)(21)NC([C@@H](NC([C@H](CCC(O)=O)NC([C@H](CCC(O)=O)NC([C@H](CC(C)C)NC([C@@H](NC([C@H](CO)NC([C@H](CC(C)C)NC([C@@H](NC([C@H](CO)NC([C@H](C(C)C)NC([C@H](CCCCN)NC([C@@H](NC([C@H](CO)NC([C@H](CCC(O)=O)NC([C@H](CC(C)C)NC([C@H](C(C)C)NC([C@@H]1CCCN1C([C@H](CC(C)C)NC([C@H](CC(C)C)NC(CNC([C@H](CCC(N)=O)NC([C@H](CCCNC(N)=N)NC([C@H](CC(C)C)NC([C@@H](NC([C@H](CCC(O)=O)NC([C@H](CC(C)C)NC([C@@H](NC([C@@H]2CCCN2C(C)=O)=O)C)=O)=O)=O)CC(O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)=O)CC3=CC=CC=C3)=O)=O)=O)=O)CC4=CC=CC=C4)=O)=O)=O)C)=O)=O)=O)=O)CC5=CC=C(O)C=C5)=O)=O)=O)=O)=O)=O.OC(C(F)(F)F)=O |
| Sequence | Ac-Pro-Ala-Leu-Glu-Asp-Leu-Arg-Gln-Gly-Leu-Leu-Pro-Val-Leu-Glu-Ser-Phe-Lys-Val-Ser-Phe-Leu-Ser-Ala-Leu-Glu-Glu-Tyr-Thr-Lys-Lys-Leu-Asn-NH₂ |
| Sequence Short | PALEDLRQGLLPVLESFKVSFLSALEEYTKKLN |
| Storage | Keep away from moisture Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |
| Solubility Information | H2O: Soluble |


