Reagentia en instrumenten voor immunologie, celbiologie en moleculaire biologie.

Teriparatide acetate [99294-94-7]

Afdrukken

Referentie T21460-100mg

Formaat : 100mg

Merk : TargetMol

Meer informatie aanvragen

Teriparatide acetate

(Synonyms: Parathar acetate, hPTH 1-34 (acetate salt), Forteo) Copy Product Info

Teriparatide acetate (Forteo) is a PHT agonist, with an IC₅₀ of 2 nM in HEK293 cells.Teriparatide acetate is a recombinant form of parathyroid hormone. It is an effective anabolic (i.e., bone growing) agent used to treat some forms of osteoporosis. Intermittent use of Teriparatide acetate activates osteoblasts more than osteoclasts, which leads to an overall increase in bone.

Cas No. 99294-94-7

For research use only—not for human use. No sales to individuals. Use as intended only.

Batch Information

Select Batch

Purity:99.90%

Color:White

Resource Download

COA HPLC-MS MS

Product Introduction

Bioactivity

Description	Teriparatide acetate (Forteo) is a PHT agonist, with an IC₅₀ of 2 nM in HEK293 cells.Teriparatide acetate is a recombinant form of parathyroid hormone. It is an effective anabolic (i.e., bone growing) agent used to treat some forms of osteoporosis. Intermittent use of Teriparatide acetate activates osteoblasts more than osteoclasts, which leads to an overall increase in bone.
Synonyms	Parathar acetate, hPTH 1-34 (acetate salt), Forteo

Chemical Properties

Molecular Weight	4177.83
Formula	C₁₈₃H₂₉₅N₅₅O₅₃S₂
Cas No.	99294-94-7
Smiles	CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CNC=N2)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC3=CNC4=CC=CC=C43)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC5=CNC=N5)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CC6=CC=CC=C6)C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CO)N.CC(=O)O
Relative Density.	no data available
Sequence	Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe
Sequence Short	SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF

Storage & Solubility Information

Storage

Keep away from moisture Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature.

Solubility Information

H2O: 20 mg/mL (4.79 mM), Sonication is recommended.

DMSO: 25 mg/mL (5.98 mM), Sonication is recommended.

Solution Preparation Table

H2O/DMSO

	1mg	5mg	10mg	50mg
1 mM	0.2394 mL	1.1968 mL	2.3936 mL	11.9679 mL

DMSO

	1mg	5mg	10mg	50mg
5 mM	0.0479 mL	0.2394 mL	0.4787 mL	2.3936 mL

Note : The dilution table applies only to solid products. For liquid products, please calculate the stock solution based on the stated concentration and/or density.