fr en es de it pt nl

Réactifs et instruments pour l'immunologie, la biologie cellulaire et la biologie moléculaire.

Anti-Human PDGFC Antibody (SAA0450)

Imprimer

Référence NB-21-43447

Conditionnement : 100µg

Marque : Neo Biotech

Demander plus d'informations

Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

Contact +33 (0)3 90 20 54 70

Available in:
us (586" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-has-children menu-item-243586" data-cards="false" data-depth="0" data-mega-menu="a" data-color="purple">
Custom antibody
- Therapeutics
  End-to-end solutions from antigen design to bioproduction
  - Antibody discovery services
    Guaranteed high-affinity and blocking fully
    human antibodies
  - Characterize antibodies AI-Powered
    Characterize your antibodies in terms of
    sequence, structure and function
  - Optimize antibodies AI-Powered
    Increase the affinity, improve the developability or humanize your antibody in just 3 weeks
  - Engineer antibodies
    Transform your antibodies into ADCs, bispecifics...
  - Recombinant Antibody Production
    From high-throughput screening to large-scale production
  - VHH Antibody Production
    Discover how VHH antibodies can accelerate the development of next-generation cancer therapeutics.
    
    Learn more
    
    Need cancer-specific antibodies faster?
    Access a unique repertoire derived from 86 cancer patients and accelerate your discovery program.
    
    Discover now
- Diagnostic & Research
  Guaranteed high-detection antibodies that works in your hands
  - Monoclonal Antibody Production
    11 applications including ELISA, WB, FC, immunoprecipitation...
  - Polyclonal Antibody Production
    From various species: mouse, rat, rabbit, goat, sheep, chicken, llama, alpaca...
  - Label antibodies
  - Recombinant Antibody Production
    From high-throughput screening to large-scale production
  - Find an antibody in stock
  - Need to produce several dozens of antibodies in parallel?
    Discover our 1mg guaranteed high-throughput antibody production service.
    
    Discover now
    
    Need to produce a few mg to g of antibodies?
    Order them at best without any comprise on quality with our transient antibody production service.
    
    Transient antibody production
- Animal health
  Guaranteed high affinity blocking antibodies for cat and dogs therapeutics
  - Generate dog antibodies
  - Generate cat antibodies
  - Produce recombinant antibodies
    From high-throughput screening to large-scale production
  - Need to produce several dozens of antibodies in parallel?
    Discover our 1mg guaranteed high-throughput antibody production service.
    
    Discover now
    
    Need to produce a few mg to g of antibodies?
    Order them at best without any comprise on quality with our recombinant antibody production service.
    
    Transient antibody production
Protein production
- High-throughput antibody production
  Discover our 1mg guaranteed high-throughput antibody production service.
- Produce your protein at small scale
  Produce mg to gram-scale of protein in one of our 5 expression systems
- Custom cell line development service
  Produce gram to kg-scale of protein with our stable cell line development platform
- Optimize your expression conditions
  Improve your protein production yield up to 50 times
- Characterize proteins
  Characterize your proteins in terms of structure, activity, stability...
- Find a recombinant protein in stock
- - Need to produce several dozens of antibodies in parallel?
    Discover our 1mg guaranteed high-throughput antibody production service.
    
    Discover now
  - Need to produce a few mg to g of antibodies?
    Order them at best without any comprise on quality with our transient antibody production service.
    
    Transient antibody expression
Peptide synthesis
- Order peptides Instant quote
  Synthesize one to thousand peptides from mg to gram-scale - From /AA
- Generate a peptide library Online tool
  Build your antibody library using a variety of strategies, including overlapping, alanine scanning, and positional scanning...
- Conjugate peptides
Gene synthesis
- Order genes
  Order instantly your genes with 100% sequence guaranteed - From /bp
- Contact our gene experts
Online shop
- Primary Antibodies
  6,000+ primary antibodies targeting various therapeutic targets, including GPCRs, immune checkpoints, and more
- Recombinant Proteins
  6,000+ recombinant proteins, including membrane proteins in micelles or nanodiscs
- ELISA assay kits
  Discover a large catalog of ELISA assay kits specially designed for the detection of various antibodies or antigens
- XtenCHO™ Race New
  Our in-house transient CHO expression system setting new records
- Cell separation media
- - Discover XtenCHO^TM Race, our new CHO expression system New
    Need a fast and cost-effective solution to produce your proteins? Discover XtenCHO^TM Race and achieve multi-gram protein production in just 8 days.
    
    Learn more
  - Are you working with membrane protein in native conformation? New
    Discover our catalog of ready-to-use proteins in micelles or nanodiscs.
    
    Discover the catalog
Why ProteoGenix?
- About us
  A science-driven partner accelerating your therapeutic and diagnostic breakthroughs.
  - Corporate social responsability
    We put responsibility at the heart of innovation for sustainable science
  - Innovation
    We make science faster, smarter and more predictable
  - Wet Lab & IA
    Connecting in silico intelligence to in vitro validation
  - Expert guidance
    Choose more than a service provider, choose a partner
- Proprietary technologies
  Proprietary platforms powering faster and more reliable development workflows.
  - AIxplore®
    Your AI Antibody Design Platform designed to optimize your antibody in weeks
  - Proprietary antibody librairies
    Discover one of the largest catalog of antibody libraries and get high-affinity antibodies in 1 month
  - XtenCHO™ Race
    Our high-performance mammalian expression system
  - RocketAbs™
    High speed immunization platform - Up to 50% faster than competitors
- Industries
  From discovery to production, across industries
  - Biopharma & biotech
    End-to-end solutions from antigen design to
    bioproduction
  - Cancer immunotherapy companies
    Innovative solutions to accelerate your immuno-oncology program.
  - Diagnostics & research
    Guaranteed solutions to detect and quantify
    your analytes
  - Animal health
    Unique solutions to create new animal
    biotherapeutics
Resources
- Together we succeed
  Discover inspiring success stories and case reports from real-world projects
  - Antibodies for CAR-T cell therapy
    Discover how phage display allowed to identify 130 antibody sequences for a CAR-T project.
  - Discovery of pHLA antibodies
    Learn how we generated 4 unique antibodies against a melanoma-associated pHLA target.
  - Discovery of PD-1-targeting VHH
    Discover how we delivered 14 VHH targeting PD-1 in just 3 weeks.
  - High-affinity bispecific antibody production
    Learn how our multi-format screening approach led to high-affinity antibodies.
  - View all our case reports
- Knowledge
  Your hub for insights: webinars, blogs, and whitepapers from ProteoGenix
  - Blog
    Discover a lot of tips and advices for your biologics development
  - Webinars
    Our experts share their knowledge to stay at the forefront of trending scientific topics.
  - Whitepapers
    Access a wealth of knowledge on biologics development
- Tools
  Tools to guide, calculate, and order your projects
  - Recombinant antibody calculator New
    Need to produce antibodies? Take 2 minutes and get your quote in 4 hours
  - Antibody quiz
    Take 2 minutes to find out the best antibody development methode for your project.
  - Peptide ordering system
    Order your peptide in 2 minutes thanks to our interactive form
  - Gene ordering system
    Order your gene in 2 minutes thanks to our interactive form
  - View all our tools

Contact Book a call

Log In

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close

SDS-PAGE for Anti-Human PDGFC Antibody (SAA0450)

Anti-Human PDGFC Antibody (SAA0450)

Datasheet

Specifications Anti-Human PDGFC Antibody (SAA0450)

Product name	ARO-A15535-100
Uniprot ID	Q9NRA1
Raw Antigen Sequence	MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTILGRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
Form	0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Human
Reference	ARO-A15535
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	PDGFC
Clone Name	SAA0450
Protein Name	PDGFC
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A15535-1MG
Uniprot ID	Q9NRA1
Raw Antigen Sequence	MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTILGRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
Form	0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Human
Reference	ARO-A15535
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	PDGFC
Clone Name	SAA0450
Protein Name	PDGFC
Target species	Anti-Human Monoclonal Antibody

Product name	ARO-A15535-50
Uniprot ID	Q9NRA1
Raw Antigen Sequence	MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTILGRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSALPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
Form	0.01M PBS, pH 7.4, 0.09% Sodium azide.
Delivery condition	Blue ice (+4°C)
Storage condition	4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand	ProteoGenix
Reactivity	Human
Reference	ARO-A15535
Isotype	IgG2a, kappa
Clonality	Monoclonal Antibody
Purification	Protein A or G purified.
Immunogen	PDGFC
Clone Name	SAA0450
Protein Name	PDGFC
Target species	Anti-Human Monoclonal Antibody

Documents

Datasheet

QC & Validation

SDS-PAGE for Anti-Human PDGFC Antibody (SAA0450)

SDS-PAGE for Anti-Human PDGFC Antibody (SAA0450)

Anti-Human PDGFC Antibody (SAA0450), on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

3D Representation

Anti-Human PDGFC Antibody (SAA0450)

Reviews

There are no reviews yet.

Be the first to review “Anti-Human PDGFC Antibody (SAA0450)” Cancel reply

Related products

ARO-A10141

Rat IgG2a, kappa Isotype Control Antibody (RTK2758), PerCP