GJA1 Protein, Human, Recombinant (His)
Référence NB-64-50048-100ug
Conditionnement : 100ug
Marque : Neo Biotech
Remove All
GJA1 Protein, Human, Recombinant (His)
(Synonyms: GJAL, GJA1, Gap junction alpha-1 protein, Gap junction 43 kDa heart protein, Connexin-43 (Cx43)) Copy Product InfoSynonyms: GJAL, GJA1, Gap junction alpha-1 protein, Gap junction 43 kDa heart protein, Connexin-43 (Cx43)
Catalog No. TMPH-01372 Copy Product Info
GJA1 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 20.3 kDa and the accession number is P17302.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | GJA1 Protein, Human, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 20.3 kDa and the accession number is P17302. |
| Species | Human |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | P17302 |
| Amino Acid | FKGVKDRVKGKSDPYHATSGALSPAKDCGSQKYAYFNGCSSPTAPLSPMSPPGYKLVTGDRNNSSCRNYNKQASEQNWANYSAEQNRMGQAGSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASSRPRPDDLEI |
| Construction | 233-382 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | GJAL, GJA1, Gap junction alpha-1 protein, Gap junction 43 kDa heart protein, Connexin-43 (Cx43) |
| Research Background | Gap junction protein that acts as a regulator of bladder capacity. A gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. May play a critical role in the physiology of hearing by participating in the recycling of potassium to the cochlear endolymph. Negative regulator of bladder functional capacity: acts by enhancing intercellular electrical and chemical transmission, thus sensitizing bladder muscles to cholinergic neural stimuli and causing them to contract. May play a role in cell growth inhibition through the regulation of NOV expression and localization. Plays an essential role in gap junction communication in the ventricles. |
| Molecular Weight | 20.3 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
GJA 1Gap junction α-1 proteinGap junction a-1 proteinConnexin43 (Cx 43)
Related Tags: GJA1 Protein, Human, Recombinant (His) chemical structure | GJA1 Protein, Human, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

