Human IZUMO1 recombinant protein

Référence NB-21-27788

Conditionnement : 100µg

Marque : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Mammalian cells
Origin species:
Human
Uniprot ID:
Q8IYV9
Molecular weight:
31.46 kDa
Cys22–Pro254 Strep

Specifications Human IZUMO1 recombinant protein

Product name PX-P6547-100
Uniprot ID Q8IYV9
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence CVICDPSVVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRITDSDVKGDLFVKELFWMLHLQKETFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQMEDMILDCELNWHQASEGLTDYSFYRVWGNNTETLVSKGKEATLTKPMVGPEDAGSYRCELGSVNSSPATIINFHVTVLP
Molecular weight 31.46 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Cys22-Pro254
Aliases /Synonyms IZUMO1, Oocyte binding/fusion factor, Sperm-specific protein izumo, OBFIzumo sperm-egg fusion protein 1,
Reference PX-P6547
Molecular Constructor
Cys22–Pro254 Strep
Product name PX-P6547-1MG
Uniprot ID Q8IYV9
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence CVICDPSVVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRITDSDVKGDLFVKELFWMLHLQKETFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQMEDMILDCELNWHQASEGLTDYSFYRVWGNNTETLVSKGKEATLTKPMVGPEDAGSYRCELGSVNSSPATIINFHVTVLP
Molecular weight 31.46 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Cys22-Pro254
Aliases /Synonyms IZUMO1, Oocyte binding/fusion factor, Sperm-specific protein izumo, OBFIzumo sperm-egg fusion protein 1,
Reference PX-P6547
Molecular Constructor
Cys22–Pro254 Strep
Product name PX-P6547-50
Uniprot ID Q8IYV9
Origin species Human
Expression system Eukaryotic expression
Raw Antigen Sequence CVICDPSVVLALKSLEKDYLPGHLDAKHHKAMMERVENAVKDFQELSLNEDAYMGVVDEATLQKGSWSLLKDLKRITDSDVKGDLFVKELFWMLHLQKETFATYVARFQKEAYCPNKCGVMLQTLIWCKNCKKEVHACRKSYDCGERNVEVPQMEDMILDCELNWHQASEGLTDYSFYRVWGNNTETLVSKGKEATLTKPMVGPEDAGSYRCELGSVNSSPATIINFHVTVLP
Molecular weight 31.46 kDa
Protein delivered with Tag? C-Terminal Strep Tag
Buffer PBS pH 7.4, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Form Liquid
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Cys22-Pro254
Aliases /Synonyms IZUMO1, Oocyte binding/fusion factor, Sperm-specific protein izumo, OBFIzumo sperm-egg fusion protein 1,
Reference PX-P6547
Molecular Constructor
Cys22–Pro254 Strep

Reviews

There are no reviews yet.

Be the first to review “Human IZUMO1 recombinant protein” Cancel reply

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call