LPA Antibody - N-terminal region

Référence ARP60282_P050-25UL

Conditionnement : 25ul

Marque : Aviva Systems Biology


LPA Antibody - N-terminal region (ARP60282_P050)

Datasheets/ManualsPrintable datasheet for anti-LPA (ARP60282_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human LPA
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: VPDPSTEASSEEAPTEQSPGVQDCYHGDGQSYRGSFSTTVTGRTCQSWSS
Concentration0.5 mg/ml
Blocking PeptideFor anti-LPA (ARP60282_P050) antibody is Catalog # AAP60282 (Previous Catalog # AAPP46470)
Gene SymbolLPA
Gene Full NameLipoprotein, Lp(a)
Alias SymbolsLP, AK38, APOA
NCBI Gene Id4018
Protein NameApolipoprotein(a)
Description of TargetLPA is a serine proteinase that inhibits the activity of tissue-type plasminogen activator I. The protein constitutes a substantial portion of lipoprotein(a) and is proteolytically cleaved, resulting in fragments that attach to atherosclerotic lesions and promote thrombogenesis. Elevated plasma levels of this protein are linked to atherosclerosis. Depending on the individual, the protein contains 2-43 copies of kringle-type domains.
Uniprot IDP08519
Protein Accession #EAW47596
Nucleotide Accession #NM_005577
Protein Size (# AA)1169
Molecular Weight120kDa
Protein InteractionsCANX; FBLN5; MMP12; LRP2; APOH; FN1; FGB; ELANE; CELA1;

Vous serez peut-être également intéressé par les produits suivants :



Référence
Description
Cond.
Prix HT
ARP70509_P050-25UL
 25ul 
ARP48303_P050-25UL
 25ul