RBPJ Peptide - middle region
Référence orb1997927-100ug
Conditionnement : 100ug
Marque : Biorbyt
Description
Images & Validation
−
Key Properties
−| Protein Sequence | Synthetic peptide located within the following region: CVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKN |
|---|
Storage & Handling
−| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−CBF1, RBP-J, RBPjk, Igkjrb, Rbpsuh, Igkrsbp, AI843960, RBP-Jkappa, RBP-J kappa
−
Quick Database Links
UniProt
RefSeq (Protein):NP_001074396.1
UniProt Details
− Loading UniProt data...
NCBI Reference Sequences
−Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product| Protein | NP_001074396.1 |
|---|
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide