RecombinantEPO,Human
Référence orb1494750-10ug
Conditionnement : 10ug
Marque : Biorbyt
Description
Key Properties
−| Source | CHO |
|---|---|
| Biological Activity | ED501 x 10ˆ6units/mg |
| Purification | > 95% as analyzed by SDS-PAGE and HPLC. |
| Endotoxins | < 0.2 EU/μg, determined by LAL method. |
| MW | Mature human EPO, containing 166 amino acid residues, has a predicted molecular mass of approximately 21 kDa. As a result of glycosylation, the recombinant protein migrates with an apparent molecular mass of 26-36 kDa in SDS-PAGE. |
| Purity | > 95% as analyzed by SDS-PAGE and HPLC. |
| Protein Sequence | APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAL LVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEA CRTGDR |
Storage & Handling
−| Storage | Lyophilized recombinant human EPO remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhEPO should be stable up to 1 week at 4°C or up to 2 months at -20°C. |
|---|---|
| Form/Appearance | Lyophilized after extensive dialysis against PBS. |
| Buffer/Preservatives | Lyophilized after extensive dialysis against PBS. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Human EPO-alpha, EPO-alpha, EPO alpha, EPOalpha, h-EPO-alpha, rh-AEPO-alpha, recombinant human EPO-alpha, recombinant EPO-alpha, EPO.
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide


