ANGPTL2 Antibody - middle region - HRP
Referência ARP54836_P050-HRP
Tamanho : 100ul
Marca : Aviva Systems Biology
ANGPTL2 Antibody - middle region : HRP (ARP54836_P050-HRP)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-ANGPTL2 (ARP54836_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human ANGL2 |
| Purification | Affinity purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: PPAAPPRVYQPPTYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLTSLPS |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-ANGPTL2 (ARP54836_P050-HRP) antibody is Catalog # AAP54836 |
| Gene Symbol | ANGPTL2 |
|---|---|
| Gene Full Name | angiopoietin like 2 |
| Alias Symbols | ARP2, HARP |
| NCBI Gene Id | 23452 |
| Protein Name | angiopoietin-related protein 2 |
| Description of Target | Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action. |
| Uniprot ID | Q9UKU9 |
| Protein Accession # | NP_036230 |
| Protein Size (# AA) | 493 |
| Molecular Weight | 54kDa |



