ARO-A14173
Anti-Human FGF2/bFGF Antibody (SAA0437), FITC
Referência NB-21-43980
Tamanho : 100µg
Tamanho : 100µg
| Product name | ARO-A10765-100 |
|---|---|
| Uniprot ID | P09038 |
| Raw Antigen Sequence | MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Buffer | 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300. |
| Delivery condition | Blue ice (+4°C) |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt. |
| Brand | ProteoGenix |
| Host species | Mouse |
| Aliases /Synonyms | Anti-bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2 |
| Reference | ARO-A10765 |
| Note | For research use only. |
| Isotype | IgG1, kappa |
| Clonality | Monoclonal Antibody |
| Target | bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2 |
| Clone Name | SAA0437 |
| Target species | Human |
| Product name | ARO-A10765-1MG |
|---|---|
| Uniprot ID | P09038 |
| Raw Antigen Sequence | MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Buffer | 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300. |
| Delivery condition | Blue ice (+4°C) |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt. |
| Brand | ProteoGenix |
| Host species | Mouse |
| Aliases /Synonyms | Anti-bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2 |
| Reference | ARO-A10765 |
| Note | For research use only. |
| Isotype | IgG1, kappa |
| Clonality | Monoclonal Antibody |
| Target | bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2 |
| Clone Name | SAA0437 |
| Target species | Human |
| Product name | ARO-A10765-50 |
|---|---|
| Uniprot ID | P09038 |
| Raw Antigen Sequence | MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Buffer | 0.01M PBS, pH 7.4, 0.2% BSA, 0.05% Proclin 300. |
| Delivery condition | Blue ice (+4°C) |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt. |
| Brand | ProteoGenix |
| Host species | Mouse |
| Aliases /Synonyms | Anti-bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2 |
| Reference | ARO-A10765 |
| Note | For research use only. |
| Isotype | IgG1, kappa |
| Clonality | Monoclonal Antibody |
| Target | bFGF, FGF2, Basic fibroblast growth factor, HBGF-2, FGFB, FGF-2, Heparin-binding growth factor 2, Fibroblast growth factor 2 |
| Clone Name | SAA0437 |
| Target species | Human |
There are no reviews yet.