CPS1 (Carbamoyl-phosphate Synthase [Ammonia], Mitochondrial, Carbamoyl-phosphate Synthetase I, CPSase I) (PE)
Referência 125289-PE-100ul
Tamanho : 100ul
Marca : US Biological
125289-PE CPS1 (Carbamoyl-phosphate Synthase [Ammonia], Mitochondrial, Carbamoyl-phosphate Synthetase I, CPSase I) (PE)
Clone Type
MonoclonalHost
mouseSource
humanIsotype
IgG1,kGrade
Affinity PurifiedApplications
FLISA IHC WBCrossreactivity
HuAccession #
NM_001875, NP_001866Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeInvolved in the urea cycle of ureotelic animals where the enzyme plays an important role in removing excess ammonia from the cell.
Applications:
Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution:
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Optimal dilutions to be determined by the researcher.
AA Sequence:
ANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA
Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.

