Envelope glycoprotein G(US4)

Referência NB-21-24564

Tamanho : 100ug

Marca : Neo Biotech


Host species:
Escherichia coli (E.coli)
Uniprot ID:
A7U885
Molecular weight:
42.8kDa
GST Ppr490–Asp649

Specifications Envelope glycoprotein G(US4)

Product name Envelope glycoprotein G(US4)
Uniprot ID A7U885
Uniprot link https://www.uniprot.org/uniprot/A7U885
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPTADSPLTASPPATAPGPSAANVSVAATTATPGTRGTARTPPTDPKTHPHGPADAPPGSPAPPPPEHRGGPEEFEGAGDGEPPDDDDSATGLAFRTPNPNKPPPARPGPIRPTLPPGILGPLAPNTPRPPAQAPAKDMPSGPTPQHIPLFWFLTASPALD
Molecular weight 42.8kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >50% by SDS-PAGE
Buffer TBS, pH 8.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ppr490-Asp649
Aliases /Synonyms Glycoprotein G,US4,gG
Reference PX-P4760
Note For research use only
Molecular Constructor
GST Ppr490–Asp649
Product name Envelope glycoprotein G(US4)
Uniprot ID A7U885
Uniprot link https://www.uniprot.org/uniprot/A7U885
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPTADSPLTASPPATAPGPSAANVSVAATTATPGTRGTARTPPTDPKTHPHGPADAPPGSPAPPPPEHRGGPEEFEGAGDGEPPDDDDSATGLAFRTPNPNKPPPARPGPIRPTLPPGILGPLAPNTPRPPAQAPAKDMPSGPTPQHIPLFWFLTASPALD
Molecular weight 42.8kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >50% by SDS-PAGE
Buffer TBS, pH 8.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ppr490-Asp649
Aliases /Synonyms Glycoprotein G,US4,gG
Reference PX-P4760
Note For research use only
Molecular Constructor
GST Ppr490–Asp649
Product name PX-P4760-1MG
Uniprot ID A7U885
Uniprot link https://www.uniprot.org/uniprot/A7U885
Expression system Prokaryotic expression
Raw Antigen Sequence MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPTADSPLTASPPATAPGPSAANVSVAATTATPGTRGTARTPPTDPKTHPHGPADAPPGSPAPPPPEHRGGPEEFEGAGDGEPPDDDDSATGLAFRTPNPNKPPPARPGPIRPTLPPGILGPLAPNTPRPPAQAPAKDMPSGPTPQHIPLFWFLTASPALD
Molecular weight 42.8kDa
Protein delivered with Tag? N-terminal GST Tag
Purity estimated >50% by SDS-PAGE
Buffer TBS, pH 8.0
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ppr490-Asp649
Aliases /Synonyms Glycoprotein G,US4,gG
Reference PX-P4760
Note For research use only
Molecular Constructor
GST Ppr490–Asp649

Documents

3D Representation

Envelope glycoprotein G(US4)

Reviews

There are no reviews yet.

Be the first to review “Envelope glycoprotein G(US4)” Cancel reply

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call