Tamanho : 100ug
| Product name | Envelope glycoprotein G(US4) |
|---|---|
| Uniprot ID | A7U885 |
| Uniprot link | https://www.uniprot.org/uniprot/A7U885 |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSPTADSPLTASPPATAPGPSAANVSVAATTATPGTRGTARTPPTDPKTHPHGPADAPPGSPAPPPPEHRGGPEEFEGAGDGEPPDDDDSATGLAFRTPNPNKPPPARPGPIRPTLPPGILGPLAPNTPRPPAQAPAKDMPSGPTPQHIPLFWFLTASPALD |
| Molecular weight | 42.8kDa |
| Protein delivered with Tag? | N-terminal GST Tag |
| Purity estimated | >50% by SDS-PAGE |
| Buffer | TBS, pH 8.0 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Ppr490-Asp649 |
| Aliases /Synonyms | Glycoprotein G,US4,gG |
| Reference | PX-P4760 |
| Note | For research use only |
| Molecular Constructor | GST Ppr490–Asp649 |