FLOT1 Peptide - middle region

Referência AAP65757

Tamanho : 100ug

Marca : Aviva Systems Biology


 

FLOT1 Peptide - middle region (AAP65757)

Data Sheet
 
Sku AAP65757
Name FLOT1 Peptide - middle region (AAP65757)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene FLOT1
Gene id 10211
Description of target Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. FLOT1 encodes a caveolae-associated, integral membrane protein. The function of flotillin 1 has not been determined.
Swissprot id O75955
Protein accession num NP_005794
Nucleotide accession num NM_005803
Protein size 427 amino acids
Molecular weight 47kDa
Species reactivity Human
Application WB
Peptide sequence IREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAY
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-FLOT1 Antibody (ARP65757_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

Você também pode estar interessado nos seguintes produtos:



Referência
Descrição
Cond.
Price Bef. VAT
4030-05
 1.0mL 
AAP61171
 100ug