Reagentes e instrumentos para imunologia, biologia celular e biologia molecular.
 
> Glucagon-Like Peptide (GLP) II, human [89750-15-2]

Glucagon-Like Peptide (GLP) II, human [89750-15-2]

Imprimir Imprimir
Please log in

Referência HY-P1841-1mg

Tamanho : 1mg

Marca : MedChemExpress


Description

Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreases apoptosis of enterocytes [1].

IC50 & Target[1]

Human Endogenous Metabolite

 

Cellular Effect
Cell Line Type Value Description References
HEK293 EC50
0.07 nM
Compound: 1
Agonist activity at human GLP2R expressed in HEK293 cells after 5 hrs by luciferase reporter gene assay
Agonist activity at human GLP2R expressed in HEK293 cells after 5 hrs by luciferase reporter gene assay
[PMID: 26986178]
HEK293 EC50
520 nM
Compound: 1
Agonist activity at human GLP1R expressed in HEK293 cells after 5 hrs by luciferase reporter gene assay
Agonist activity at human GLP1R expressed in HEK293 cells after 5 hrs by luciferase reporter gene assay
[PMID: 26986178]
Masse moléculaire

3766.20

Formule

C165H254N44O55S
CAS No.
Sequence

His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp
Sequence Shortening

HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Structure Classification
Initial Source
Livraison

Room temperature in continental US; may vary elsewhere.
Stockage

Please store the product under the recommended conditions in the Certificate of Analysis.
Solvant et solubilité
In Vitro: 

H2O

Peptide Solubility and Storage Guidelines:

1.  Calculate the length of the peptide.

2.  Calculate the overall charge of the entire peptide according to the following table:

  Contents Assign value
Acidic amino acid Asp (D), Glu (E), and the C-terminal -COOH. -1
Basic amino acid Arg (R), Lys (K), His (H), and the N-terminal -NH2 +1
Neutral amino acid Gly (G), Ala (A), Leu (L), Ile (I), Val (V), Cys (C), Met (M), Thr (T), Ser (S), Phe (F), Tyr (Y), Trp (W), Pro (P), Asn (N), Gln (Q) 0

3.  Recommended solution:

Overall charge of peptide Details
Negative (<0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, add NH4OH (<50 μL).
3.  If the peptide still does not dissolve, add DMSO (50-100 μL) to solubilize the peptide.
Positive (>0) 1.  Try to dissolve the peptide in water first.
2.  If water fails, try dissolving the peptide in a 10%-30% acetic acid solution.
3.  If the peptide still does not dissolve, try dissolving the peptide in a small amount of DMSO.
Zero (=0) 1.  Try to dissolve the peptide in organic solvent (acetonitrile, methanol, etc.) first.
2.  For very hydrophobic peptides, try dissolving the peptide in a small amount of DMSO, and then dilute the solution with water to the desired concentration.
Pureté et documentation
Références