Human growth hormone-releasing factor TFA
Referência T75713-50mg
Tamanho : 50mg
Marca : TargetMol
Human growth hormone-releasing factor TFA
Copy Product InfoHuman Growth Hormone-Releasing Factor TFA, also known as Growth Hormone-Releasing Factor Human TFA, is a hypothalamic polypeptide that promotes the production and release of growth hormone (GH) through its interaction with the Growth Hormone-Releasing Hormone Receptor (GHRHR) on anterior pituitary cells [1].
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Description | Human Growth Hormone-Releasing Factor TFA, also known as Growth Hormone-Releasing Factor Human TFA, is a hypothalamic polypeptide that promotes the production and release of growth hormone (GH) through its interaction with the Growth Hormone-Releasing Hormone Receptor (GHRHR) on anterior pituitary cells [1]. |
| Molecular Weight | 5153.67 |
| Formula | C217H359F3N72O68S |
| Sequence | Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH₂ |
| Sequence Short | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
| Storage | Keep away from moisture, Powder: -20°C for 3 years | In solvent: -80°C for 1 year Shipping with blue ice/Shipping at ambient temperature. |


