iagB Recombinant Protein
Referência OPCA03127-20UG
Tamanho : 20ug
Marca : Aviva Systems Biology
IAGB Recombinant Protein (Salmonella typhimurium) (OPCA03127)
| Datasheets/Manuals | Printable datasheet for IAGB Recombinant Protein (Salmonella typhimurium) (OPCA03127) |
|---|
| Predicted Species Reactivity | Salmonella enterica|Salmonella typhimurium |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Salmonella typhimurium |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | DCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYRKLKGMSAEEKNKRLSIAANK |
| Protein Sequence | DCWLQAEKMFNIESELLYAIAQQESAMKPGAIGHNRDGSTDLGLMQINSFHMKRLKKMGISEKQLLQDPCISVIVGASILSDMMKIYGYSWEAVGAYNAGTSPKRSDIRKRYAKKIWENYRKLKGMSAEEKNKRLSIAANK |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 20-160 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | Complete genome sequence of Salmonella enterica serovar Typhimurium LT2.McClelland M., Sanderson K.E., Spieth J., Clifton S.W., Latreille P., Courtney L., Porwollik S., Ali J., Dante M., Du F., Hou S., Layman D., Leonard S., Nguyen C., Scott K., Holmes A., Grewal N., Mulvaney E. Wilson R.K.Nature 413:852-856(2001) |
|---|---|
| Gene Symbol | iagB |
| Gene Full Name | invasion protein IagB |
| Alias Symbols | STM2877. |
| NCBI Gene Id | 1254400 |
| Protein Name | Invasion protein iagB |
| Uniprot ID | P0CL15 |
| Protein Accession # | NP_461798.1 |
| Nucleotide Accession # | NC_003197.1 |
| Protein Size (# AA) | Full Length of Mature Protein |
| Molecular Weight | 32 kDa |