Host species: Escherichia coli (E.coli) Origin species: Homo sapiens (Human) Uniprot ID: P35225 Molecular weight: 14.54 kDa His Pro36–Asn146 Datasheet MSDS Specifications IL13 recombinant protein Product name PX-P5175-100 Uniprot ID P35225 Uniprot link https://www.uniprot.org/uniprot/P35225 Origin species Homo sapiens (Human) Expression system Prokaryotic expression Raw Antigen Sequence PVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN Molecular weight 14.54 kDa Protein delivered with Tag? N-terminal His Tag Purity estimated >90% as determined by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Pro36-Asn146 Protein Accession P35225 Aliases /Synonyms NC30, Interleukin-13 Reference PX-P5175 Note For research use only Molecular Constructor His Pro36–Asn146 Product name PX-P5175-1MG Uniprot ID P35225 Uniprot link https://www.uniprot.org/uniprot/P35225 Origin species Homo sapiens (Human) Expression system Prokaryotic expression Raw Antigen Sequence PVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN Molecular weight 14.54 kDa Protein delivered with Tag? N-terminal His Tag Purity estimated >90% as determined by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Pro36-Asn146 Protein Accession P35225 Aliases /Synonyms NC30, Interleukin-13 Reference PX-P5175 Note For research use only Molecular Constructor His Pro36–Asn146 Product name PX-P5175-50 Uniprot ID P35225 Uniprot link https://www.uniprot.org/uniprot/P35225 Origin species Homo sapiens (Human) Expression system Prokaryotic expression Raw Antigen Sequence PVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN Molecular weight 14.54 kDa Protein delivered with Tag? N-terminal His Tag Purity estimated >90% as determined by SDS-PAGE Buffer PBS, pH7.5 Delivery condition Dry Ice Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) Brand ProteoGenix Host species Escherichia coli (E.coli) Fragment Type Pro36-Asn146 Protein Accession P35225 Aliases /Synonyms NC30, Interleukin-13 Reference PX-P5175 Note For research use only Molecular Constructor His Pro36–Asn146 Documents Datasheet MSDS 3D Representation Reviews There are no reviews yet. Be the first to review “IL13 recombinant protein” Cancel reply
There are no reviews yet.