LL-37, human [154947-66-7]

Referência HY-P1222-5mg

Tamanho : 5mg

Marca : MedChemExpress


Description

LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing[1][2][3].

Cellular Effect
Cell Line Type Value Description References
MRC5 IC50
64 μM
Compound: LL-37
Cytotoxicity against human MRC5 cells assessed as cell growth inhibition measured after 4 hrs by MTT assay
Cytotoxicity against human MRC5 cells assessed as cell growth inhibition measured after 4 hrs by MTT assay
[PMID: 34342438]
In Vitro

LL-37, human (1-20 μg/mL; 24 h) affects HCECs migration[2].
LL-37, human (0.0001-5 μg/mL;6-24 h) affects cytokine secretion in HCECs[2].
LL-37, human (1-100 μg/mL; 24 h) shows dose-dependently cytotoxic to HCECs at concentrations over 10 μg /mL[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Cell Migration Assay [2]

Cell Line: Human corneal epithelial cell (HCEC)
Concentration: 1, 2.5, 5, 10 and 20 μg/mL
Incubation Time: 24 hours
Result: Dose-dependently stimulated HCEC migration but showed no effect on cell proliferation.

Cell Viability Assay[2]

Cell Line: Human corneal epithelial cell (HCEC)
Concentration: 0.0001, 0.001, 0.01, 0.1, 0.5, 1, and 5 μg/mL
Incubation Time: 6 and 24 hours
Result: Dose-dependently increased IL-8, IL-6, IL-1β and TNF-α secretion at 6 and 24 hours in HCEC.
In Vivo

LL-37, human (0.4-2.0 mg/kg; intratracheal injection once) ameliorates MRSA-induced pneumonia of mice[3].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model: 6-8 week-old C57BL/6 mice with MRSA-induced pneumonia[3]
Dosage: 0.4, 0.8, 1.2, 1.6 and 2.0 mg/kg
Administration: Intratracheal injection; 0.4-2.0 mg/kg once
Result: Decreased IL-6 and TNF-α release to attenuated MRSA-induced pneumonia of testing mice.
Masse moléculaire

4493.26

Formule

C205H340N60O53

CAS No.
Appearance

Solid

Color

White to off-white

Sequence

Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser

Sequence Shortening

[LL-37, 37 aa]

Livraison

Room temperature in continental US; may vary elsewhere.

Stockage

Sealed storage, away from moisture and light, under nitrogen

Powder -80°C 2 years
-20°C 1 year

*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen)

Solvant et solubilité
In Vitro: 

H2O : 50 mg/mL (11.13 mM; Need ultrasonic)

Preparing
Stock Solutions
Concentration Solvent Mass 1 mg 5 mg 10 mg
1 mM 0.2226 mL 1.1128 mL 2.2256 mL
5 mM 0.0445 mL 0.2226 mL 0.4451 mL
View the Complete Stock Solution Preparation Table

* Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture and light, under nitrogen). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.

* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.

  • Calculateur de molarité

  • Calculateur de dilution

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:

Dosage

mg/kg

Animal weight
(per animal)

g

Dosing volume
(per animal)

μL

Number of animals

Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration: mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
Pureté et documentation
Références

Você também pode estar interessado nos seguintes produtos:



Referência
Descrição
Cond.
Price Bef. VAT
228-11059-2
 5mg 
228-11059-3
 10mg 
HY-B0108-50mg
 50mg