Phox2b Antibody - N-terminal region

Referência ARP38407_P050-25UL

Tamanho : 25ul

Marca : Aviva Systems Biology


Phox2b Antibody - N-terminal region (ARP38407_P050)

Datasheets/ManualsPrintable datasheet for anti-Phox2b (ARP38407_P050) antibody
Product Info
Tested Species ReactivityRat
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Rat Phox2b
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTT
Concentration0.5 mg/ml
Blocking PeptideFor anti-Phox2b (ARP38407_P050) antibody is Catalog # AAP38407
Gene SymbolPhox2b
Alias SymbolsNBPhox
NCBI Gene Id364152
Description of TargetThe function of this protein remains unknown.
Protein Accession #XP_001077800
Nucleotide Accession #XM_001077800
Protein Size (# AA)270
Molecular Weight29kDa

Você também pode estar interessado nos seguintes produtos:



Referência
Descrição
Cond.
Price Bef. VAT
ARP58528_P050-25UL
 25ul 
ARP35122_T100-25UL
 25ul 
ARP31243_P050
 100ul