Recombinant Gallus gallus Allergen Gal d I Protein, N-His

Referência NB-21-32356

Tamanho : 100µg

Marca : Neo Biotech


Recombinant Gallus gallus Allergen Gal d I Protein, N-His

Product name ARO-P15710-100
Uniprot ID P01005
Origin species Chicken
Expression system Prokaryotic expression
Raw Antigen Sequence EVDCSRFPNATDKEGKDVLVCNKDLRPICGTDGVTYTNDCLLCAYSIEFGTNISKEHDGECKETVPMNCSSYANTTSEDGKVMVLCNRAFNPVCGTDGVTYDNECLLCAHKVEQGASVDKRHDGGCRKELAAVSVDCSEYPKPDCTAEDRPLCGSDNKTYGNKCNFCNAVVESNGTLTLSHFGKC
Molecular weight 22.32 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Host species Escherichia coli (E.coli)
Fragment Type Glu26-Cys210
Aliases /Synonyms Ovomucoid, Allergen Gal d I, Gal d 1
Reference ARO-P15710
Note For research use only.
Molecular Constructor
His Glu26–Cys210