Recombinant Human SH3 and multiple ankyrin repeat domains protein 3 (SHANK3), partial
Referência orb3003934-100ug
Tamanho : 100ug
Marca : Biorbyt
Recombinant Human SH3 and multiple ankyrin repeat domains protein 3 (SHANK3), partial
SKU: orb3003934
Description
Research Area
Neuroscience
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | C-terminal hFc1-tagged |
| Expression Region | 1-99aa |
| Protein Length | Partial |
| Endotoxins | Not test |
| MW | 40.0 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | MQLSRAAAAAAAAPAEPPEPLSPAPAPAPAPPGPLPRSAADGAPAGGKGGPGRRAESPGAPFPGASGPGPGPGAGMDGPGASAVVVRVGIPDLQQTKCL |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
−
Recombinant Human SH3 and multiple ankyrin repeat domains protein 3 (SHANK3), partial [orb3003980]
Greater than 90% as determined by SDS-PAGE.
18.1 kDa
E.coli
1 mg, 100 μg, 20 μg
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide