RVFV (strain ZH-548 M12) Nucleoprotein/NP Protein (His)
Referência NB-64-166742-5ug
Tamanho : 5ug
Marca : Neo Biotech
Remove All
RVFV (strain ZH-548 M12) Nucleoprotein/NP Protein (His)
(Synonyms: Nucleoprotein, Nucleocapsid protein (Protein N)) Copy Product InfoSynonyms: Nucleoprotein, Nucleocapsid protein (Protein N)
Catalog No. TMPH-04816 Copy Product Info
RVFV (strain ZH-548 M12) Nucleoprotein/NP Protein (His) is expressed in Yeast. The accesssion number is P21700.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | RVFV (strain ZH-548 M12) Nucleoprotein/NP Protein (His) is expressed in Yeast. The accesssion number is P21700. |
| Species | RVFV |
| Expression System | P. pastoris (Yeast) |
| Tag | C-6xHis |
| Accession Number | P21700 |
| Amino Acid | MDNYQELRVQFAAQAVDRNEIEQWVREFAYQGFDARRVIELLKQYGGADWEKDAKKMIVLALTRGNKPRRMMMKMSKEGKATVEALINKYKLKEGNPSRDELTLSRVAAALAGWTCQALVVLSEWLPVTGTTMDGLSPAYPRHMMHPSFAGMVDPSLPGDYLRAILDAHSLYLLQFSRVINPNLRGRTKEEVAATFTQPMNAAVNSNFISHEKRREFLKAFGLVDSNGKPSAAVMAAAQAYKTAA |
| Construction | 1-245 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris/PBS-based buffer |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Nucleoprotein, Nucleocapsid protein (Protein N) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
RVFV(strainZH548M12)Nucleoprotein/NPProtein(His)
Related Tags:
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

