SOX9 (NM_000346) Human Mass Spec Standard

Referência PH308944

Tamanho : 10ug


SOX9 (NM_000346) Human Mass Spec Standard

Be the first to review this product
SKU
PH308944
SOX9 MS Standard C13 and N15-labeled recombinant protein (NP_000337)
 
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC208944
Predicted MW 56 kDa
Protein Sequence
Protein Sequence
>RC208944 representing NM_000346
Red=Cloning site Green=Tags(s)

MNLLDPFMKMTDEQEKGLSGAPSPTMSEDSAGSPCPSGSGSDTENTRPQENTFPKGEPDLKKESEEDKFP
VCIREAVSQVLKGYDWTLVPMPVRVNGSSKNKPHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLG
KLWRLLNESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSVKNGQAEAEEATEQTHISPNAIFKALQAD
SPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPKTDVQPGKADLKREGRPLPEGGRQPPIDFRDVDIGELSS
DVISNIETFDVNEFDQYLPPNGHPGVPATHGQVTYTGSYGISSTAATPASAGHVWMSKQQAPPPPPQQPP
QAPPAPQAPPQPQAAPPQQPAAPPQQPQAHTLTTLSSEPGQSQRTHIKTEQLSPSHYSEQQQHSPQQIAY
SPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIP
QTHSPQHWEQPVYTQLTRP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000337
RefSeq Size 3935
RefSeq ORF 1527
Synonyms CMD1; CMPD1; SRA1; SRXX2; SRXY10
Locus ID 6662
UniProt ID P48436
Cytogenetics 17q24.3
Summary The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. provided by RefSeq, Jul 2008
Protein Families Adult stem cells, Druggable Genome, Embryonic stem cells, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors
SKU Description Size
LC424779 Lyophilized SOX9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY424779 Transient overexpression lysate of SRY (sex determining region Y)-box 9 (SOX9) (as WB positive control) 100 ug
TP308944 Recombinant protein of human SRY (sex determining region Y)-box 9 (SOX9), 20 µg 20 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products