TAAR1 antibody
Referência orb588985-100ul
Tamanho : 100ul
Marca : Biorbyt
Contactar o distribuidor local :
Telefone : +1 850 650 7790
TAAR1 antibody
Catalog Number: orb588985
| Catalog Number | orb588985 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to TAAR1 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Human |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human TAAR1 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 39 kDa |
| Target | TAAR1 |
| UniProt ID | Q96RJ0 |
| Protein Sequence | Synthetic peptide located within the following region: NDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVD |
| NCBI | NP_612200.1 |
| Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | TA1, TAR1, TRAR1 |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |