Thioredoxin 1(trxA) (Escherichia coli)

Referência NB-21-25226

Tamanho : 50ug

Marca : Neo Biotech


Origin species:
Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Uniprot ID:
P0AA26
Met1–Ala110 His

Specifications Thioredoxin 1(trxA) (Escherichia coli)

Product name Thioredoxin 1(trxA) (Escherichia coli)
Uniprot ID P0AA26
Uniprot link https://www.uniprot.org/uniprot/P0AA26
Origin species Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Expression system Prokaryotic expression
Raw Antigen Sequence MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLALEHHHHHH
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Fragment Type Met1-Ala110
Protein Accession P0AA26
Spec:SwissProtID Q8XAT2
NCBI Reference P0AA26
Aliases /Synonyms Trx-1
Reference PX-P4691
Note For research use only
Molecular Constructor
Met1–Ala110 His
Product name Thioredoxin 1(trxA) (Escherichia coli)
Uniprot ID P0AA26
Uniprot link https://www.uniprot.org/uniprot/P0AA26
Origin species Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Expression system Prokaryotic expression
Raw Antigen Sequence MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLALEHHHHHH
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Fragment Type Met1-Ala110
Protein Accession P0AA26
Spec:SwissProtID Q8XAT2
NCBI Reference P0AA26
Aliases /Synonyms Trx-1
Reference PX-P4691
Note For research use only
Molecular Constructor
Met1–Ala110 His

Documents

Reviews

There are no reviews yet.

Be the first to review “Thioredoxin 1(trxA) (Escherichia coli)” Cancel reply

Related products

  • PTX17851

    Anti His tag mouse monoclonal antibody