VDAC1 Antibody - C-terminal region
Referência ARP35122_T100-25UL
Tamanho : 25ul
Marca : Aviva Systems Biology
VDAC1 Antibody - C-terminal region (ARP35122_T100)
| Datasheets/Manuals | Printable datasheet for anti-VDAC1 (ARP35122_T100) antibody |
|---|
| Publications | ArduÃno, D. M. et al. Mitochondrial metabolism in Parkinsonâ, 4680-702 (2012). 2284349616-211 (2009). 197751891$s> Rousset, F., Nguyen, M. V. C., Grange, L., Morel, F. & Lardy, B. Heme oxygenase-1 regulates matrix metalloproteinase MMP-1 secretion and chondrocyte cell death via Nox4 NADPH oxidase activity in chondrocytes. PLoS One 8, e66478 (2013). 238404831$s> |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | IHC, WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human VDAC1 |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86% |
| Peptide Sequence | Synthetic peptide located within the following region: SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-VDAC1 (ARP35122_T100) antibody is Catalog # AAP35122 (Previous Catalog # AAPP06353) |
| Sample Type Confirmation | VDAC1 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
| Reference | Zheng,Y., et al., (2004) Oncogene 23 (6), 1239-1247 |
|---|---|
| Gene Symbol | VDAC1 |
| Gene Full Name | Voltage-dependent anion channel 1 |
| Alias Symbols | PORIN, VDAC-1 |
| NCBI Gene Id | 7416 |
| Protein Name | Voltage-dependent anion-selective channel protein 1 |
| Description of Target | The voltage-dependent anion-selective channel 1 (VDAC1) functions as a channel in membranous structures for the outer mitochondrial membrane, the cell membrane, endosomes, caveolae, the sarcoplasmatic reticulum, synaptosomes, and post-synaptic density fraction. A major function of VDAC1 in the plasma membrane is that of a NADH(-ferricyanide) reductase that may be involved in the maintenance of cellular redox homeostasis. |
| Uniprot ID | Q5FVE7 |
| Protein Accession # | NP_003365 |
| Nucleotide Accession # | NM_003374 |
| Protein Size (# AA) | 283 |
| Molecular Weight | 31kDa |
| Protein Interactions | UBC; KLHL40; SPRTN; MDM2; ADRB2; ASB14; ASB17; PARK2; BAG3; env; VCAM1; HK1; ATF2; FMNL1; TUBA1B; MDC1; CAV1; Htt; SFXN3; SUGP1; UBAP2; UFM1; ACAD9; MGAT4B; ACAA2; ZMPSTE24; VAPA; ALDH5A1; SF1; VDAC3; VDAC2; UBA52; TIAL1; FLOT2; CDK2; SIRT7; SUMO4; MAPK3; |







