Zinc metalloproteinase aureolysin Protein, S. aureus, Recombinant (His & Myc)

Referência NB-64-52249-100ug

Tamanho : 100ug

Marca : Neo Biotech


Product Information

Biological Activity
Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first.
Description
Zinc metalloproteinase aureolysin Protein, S. aureus, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 40.2 kDa and the accession number is P81177.
Species
Staphylococcus aureus
Expression System
E. coli
TagN-10xHis, C-Myc
Accession NumberP81177
Synonyms
Zinc metalloproteinase aureolysin,Staphylococcus aureus neutral proteinase,aur
Amino Acid
AATGTGKGVLGDTKDININSIDGGFSLEDLTHQGKLSAYNFNDQTGQATLITNEDENFVKDDQRAGVDANYYAKQTYDYYKNTFGRESYDNHGSPIVSLTHVNHYGGQDNRNNAAWIGDKMIYGDGDGRTFTNLSGANDVVAHELTHGVTQETANLEYKDQSGALNESFSDVFGYFVDDEDFLMGEDVYTPGKEGDALRSMSNPEQFGQPSHMKDYVYTEKDNGGVHTNSGIPNKAAYNVIQAIGKSKSEQIYYRALTEYLTSNSNFKDCKDALYQAAKDLYDEQTAEQVYEAWNEVGVE
Construction
210-509 aa
Protein Purity
> 85% as determined by SDS-PAGE.
Molecular Weight40.2 kDa (predicted)
Endotoxin< 1.0 EU/μg of the protein as determined by the LAL method.
FormulationTris-based buffer, 50% glycerol
Reconstitution
A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information.
Stability & Storage
Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots.
ShippingIn general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice.
Research Background
Plays an essential role in immune evasion by helping bacteria to resist complement-mediated killing by neutrophils. Inhibits the deposition of host C3b on bacterial surfaces and the release of the chemoattractant C5a by cleaving the central complement protein C3. The cleavage site renders the C3b molecule vulnerable to proteolytic degradation by host regulators. Cleaves and inactivates host SERPINA1, which is an endogenous protease inhibitor essential for controlling neutrophil serine protease elastase. Plays also an essential role in the cleavage and subsequent activation of the serine protease SspA which is involved in colonization and infection of human tissues.

Dose Conversion

You can also refer to dose conversion for different animals. More

Você também pode estar interessado nos seguintes produtos:



Referência
Descrição
Cond.
Price Bef. VAT