ZP3 Antibody

Referência orb527042-100ug

Tamanho : 100ug

Marca : Biorbyt

Contactar o distribuidor local :


Telefone : +1 850 650 7790

    ZP3 Antibody

    Catalog Number: orb527042

    Catalog Numberorb527042
    CategoryAntibodies
    DescriptionZP3 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    ReactivityHuman
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence of human ZP3 (LRLMEENWNAEKRSPTFHLGDAAHLQAEIHT).
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Dilution rangeWestern blot, 0.1-0.5μg/ml
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW47 kDa
    UniProt IDP21754
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesZona pellucida sperm-binding protein 3; Sperm rece
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    ZP3 Antibody

    WB analysis of ZP3 using anti-ZP3 antibody.Lane 1:human HeLa cell;2:human placenta tissue;3:human A549 cell;4:human T-47D cell;5:human PC-3 cell;6:human U2OS cell.