Reagentes e instrumentos para imunologia, biologia celular e biologia molecular.
 
> Anti-Human ESRRB Polyclonal Antibody

Anti-Human ESRRB Polyclonal Antibody

Imprimir Imprimir
Please log in

Referência NB-21-39662

Tamanho : 100µg

Marca : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG
Anti-Human ESRRB Polyclonal Antibody binds to Recombinant Human ESRRB Protein, N-His in WB Assay

Specifications Anti-Human ESRRB Polyclonal Antibody

Product name PTX20704-100
Uniprot ID O95718
Raw Antigen Sequence GDIKALTTLCDLADRELVVIIGWAKHIPGFSSLSLGDQMSLLQSAWMEILILGIVYRSLPYDDKLVYAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALANSDSMYIEDLEAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVPMHKLFLEMLEAKV
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-ESRRB
Isotype IgG
Clonality Polyclonal Antibody
Protein Name ESRRB
Dilution ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000
Product name PTX20704-1MG
Uniprot ID O95718
Raw Antigen Sequence GDIKALTTLCDLADRELVVIIGWAKHIPGFSSLSLGDQMSLLQSAWMEILILGIVYRSLPYDDKLVYAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALANSDSMYIEDLEAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVPMHKLFLEMLEAKV
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-ESRRB
Isotype IgG
Clonality Polyclonal Antibody
Protein Name ESRRB
Dilution ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000
Product name PTX20704-50
Uniprot ID O95718
Raw Antigen Sequence GDIKALTTLCDLADRELVVIIGWAKHIPGFSSLSLGDQMSLLQSAWMEILILGIVYRSLPYDDKLVYAEDYIMDEEHSRLAGLLELYRAILQLVRRYKKLKVEKEEFVTLKALALANSDSMYIEDLEAVQKLQDLLHEALQDYELSQRHEEPWRTGKLLLTLPLLRQTAAKAVQHFYSVKLQGKVPMHKLFLEMLEAKV
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-ESRRB
Isotype IgG
Clonality Polyclonal Antibody
Protein Name ESRRB
Dilution ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000

Documents

QC & Validation

Anti-Human ESRRB Polyclonal Antibody binds to Recombinant Human ESRRB Protein, N-His in WB Assay

Anti-Human ESRRB Polyclonal Antibody binds to Recombinant Human ESRRB Protein, N-His in WB Assay

Recombinant Human ESRRB Protein, N-His(cat. No.ARO-P10006) can bind Anti-Human ESRRB Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

Reviews

There are no reviews yet.

Be the first to review “Anti-Human ESRRB Polyclonal Antibody” Cancel reply

Related products

  • ARO-P10006

    Recombinant Human ESRRB Protein, N-His