CACNB1 antibody - middle region

Referência ARP35580_P050

Tamanho : 100ul

Marca : Aviva Systems Biology

Contactar o distribuidor local :


Telefone : +1 850 650 7790

Datasheets/ManualsPrintable datasheet for anti-CACNB1 (ARP35580_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CACNB1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: KVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACE
Concentration0.5 mg/ml
Blocking PeptideFor anti-CACNB1 (ARP35580_P050) antibody is Catalog # AAP35580 (Previous Catalog # AAPP23765)
Subunitbeta-1
ReferenceOlsen,J.V., (2006) Cell 127 (3), 635-648
Gene SymbolCACNB1
Gene Full NameCalcium channel, voltage-dependent, beta 1 subunit
Alias SymbolsCAB1, CCHLB1, CACNLB1
NCBI Gene Id782
Protein NameVoltage-dependent L-type calcium channel subunit beta-1
Description of TargetCACNB1 belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage d
Uniprot IDQ02641-2
Protein Accession #NP_954855
Nucleotide Accession #NM_199247
Protein Size (# AA)523
Molecular Weight58kDa
Protein InteractionsSRPK1; APP; ATN1; NEDD4L; UBC; REM1; DYNLL1; CACNA1A;
  1. What is the species homology for "CACNB1 Antibody - middle region (ARP35580_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "CACNB1 Antibody - middle region (ARP35580_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CACNB1 Antibody - middle region (ARP35580_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CACNB1 Antibody - middle region (ARP35580_P050)"?

    This target may also be called "CAB1, CCHLB1, CACNLB1" in publications.

  5. What is the shipping cost for "CACNB1 Antibody - middle region (ARP35580_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "CACNB1 Antibody - middle region (ARP35580_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CACNB1 Antibody - middle region (ARP35580_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "58kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CACNB1 Antibody - middle region (ARP35580_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CACNB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CACNB1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CACNB1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CACNB1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CACNB1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CACNB1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Você também pode estar interessado nos seguintes produtos:



Referência
Descrição
Cond.
Price Bef. VAT
ARP36744_P050
 100ul 
ARP34954_P050
 100ul