CDKL4 Antibody - N-terminal region - Biotin
Referência ARP69686_P050-Biotin
Tamanho : 100ul
Tamanho : 100ul
| Datasheets/Manuals | Printable datasheet for anti-CDKL4 (ARP69686_P050-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human CDKL4 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 93%; Goat: 79%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 79%; Zebrafish: 79% |
| Peptide Sequence | Synthetic peptide located within the following region: EKYEKLAKTGEGSYGVVFKCRNKTSGQVVAVKKFVESEDDPVVKKIALRE |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-CDKL4 (ARP69686_P050-Biotin) antibody is Catalog # AAP69686 |
| Gene Symbol | CDKL4 |
|---|---|
| Alias Symbols | - |
| NCBI Gene Id | 344387 |
| Protein Name | Cyclin-dependent kinase-like 4 |
| Description of Target | The function of this protein remains unknown. |
| Uniprot ID | Q5MAI5 |
| Protein Accession # | NP_001009565 |
| Nucleotide Accession # | NM_001009565 |
| Protein Size (# AA) | 315 |
| Molecular Weight | 36kDa |