DTX2 Rabbit Polyclonal Antibody (HRP)
Referência orb2120924-100ul
Tamanho : 100ul
Marca : Biorbyt
Description
Images & Validation
−
| Tested Applications | WB |
|---|---|
| Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
Related Conjugates & Formulations
−Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human DTX2 |
| Protein Sequence | Synthetic peptide located within the following region: EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE |
| Molecular Weight | 62kDa |
| Purification | Affinity Purified |
| Conjugation | HRP |
Storage & Handling
−| Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−RNF58
−
DTX2 Rabbit Polyclonal Antibody (HRP) [orb470510]
ELISA, IHC-Fr, IHC-P, WB
Equine, Human, Mouse, Rat, Zebrafish
Rabbit
Polyclonal
HRP
100 μl
Quick Database Links
UniProt
RefSeq (Protein):NP_001096066
UniProt Details
− No UniProt data available
NCBI Reference Sequences
−Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product| Protein | NP_001096066 |
|---|
Protocol Information
WB
Western Blot (IB, immunoblot)