GSP1, Recombinant, Saccharomyces cerevisiae, aa2-219, His-Tag (GTP-binding Nuclear Protein GSP1/CNR1)

Referência 373539-20ug

Tamanho : 20ug

Marca : US Biological



373539 GSP1, Recombinant, Saccharomyces cerevisiae, aa2-219, His-Tag (GTP-binding Nuclear Protein GSP1/CNR1)

Swiss Prot
P32835
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

GTP-binding protein involved in nucleoCytoplasmic domain transport. Required for the import of protein into the nucleus and also for RNA export. Essential for cell viability. By analogy with Ras, Ran may be activated when GTP is exchanged for bound GDP by RCC1 and inactivated when GTP is hydrolyzed by Ran upon activation by RanGAP1.

Full length recombinant protein corresponding to aa2-219 from saccharomyces cerevisiae (strain ATCC 204508/S288c) GSP1, fused to 6X His-Tag at N-terminal, expressed in Yeast.

Molecular Weight:
~26.7kD

Amino Acid Sequence:
SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL

Storage and Stability:
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, Yeast|Purity: ≥90% (SDS-PAGE)|Form: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity
≥90% (SDS-PAGE)
References
1. "Regulation of RNA processing and transport by a nuclear guanine nucleotide release protein and members of the Ras superfamily." Kadowaki T., Goldfarb D., Spitz L.M., Tartakoff A.M., Ohno M.EMBO J. 12:2929-2937(1993).