HMGCS2 antibody - N-terminal region

Referência ARP41562_T100

Tamanho : 100ul

Marca : Aviva Systems Biology

Contactar o distribuidor local :


Telefone : +1 850 650 7790

Datasheets/ManualsPrintable datasheet for anti-HMGCS2 (ARP41562_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HMGCS2
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: PKDVGILALEVYFPAQYVDQTDLEKYNNVEAGKYTVGLGQTRMGFCSVQE
Concentration1.0 mg/ml
Blocking PeptideFor anti-HMGCS2 (ARP41562_T100) antibody is Catalog # AAP41562 (Previous Catalog # AAPP24247)
ReferenceBouchard,L., (2001) Pediatr. Res. 49 (3), 326-331
Publications

Diacylglycerol acyltransferase-1 inhibition enhances intestinal fatty acid oxidation and reduces energy intake in rats. J Lipid Res. 54, 1369-84 (2013). 23449193

Karimian Azari, E., Leitner, C., Jaggi, T., Langhans, W. & Mansouri, A. Possible role of intestinal fatty acid oxidation in the eating-inhibitory effect of the PPAR-a agonist Wy-14643 in high-fat diet fed rats. PLoS One 8, e74869 (2013). 24069361

Metabolic Adaptation of the Small Intestine to Short- and Medium-Term High-Fat Diet Exposure. J. Cell. Physiol. 232, 167-75 (2017). 27061934

Description
Gene SymbolHMGCS2
Gene Full Name3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial)
NCBI Gene Id3158
Protein NameHydroxymethylglutaryl-CoA synthase, mitochondrial
Description of TargetHMGCS2 condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.
Uniprot IDP54868
Protein Accession #NP_005509
Nucleotide Accession #NM_005518
Protein Size (# AA)508
Molecular Weight56kDa
Protein InteractionsUBC; APP; YWHAQ;
  1. What is the species homology for "HMGCS2 Antibody - N-terminal region (ARP41562_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "HMGCS2 Antibody - N-terminal region (ARP41562_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HMGCS2 Antibody - N-terminal region (ARP41562_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HMGCS2 Antibody - N-terminal region (ARP41562_T100)"?

    This target may also be called "" in publications.

  5. What is the shipping cost for "HMGCS2 Antibody - N-terminal region (ARP41562_T100)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "HMGCS2 Antibody - N-terminal region (ARP41562_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HMGCS2 Antibody - N-terminal region (ARP41562_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "56kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HMGCS2 Antibody - N-terminal region (ARP41562_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HMGCS2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HMGCS2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HMGCS2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HMGCS2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HMGCS2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HMGCS2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.