Reagentes e instrumentos para imunologia, biologia celular e biologia molecular.
 
> HSPA8 Rabbit Polyclonal Antibody (HRP)

HSPA8 Rabbit Polyclonal Antibody (HRP)

Imprimir Imprimir
Please log in

Referência orb2114378-100ul

Tamanho : 100ul

Marca : Biorbyt


HSPA8 Rabbit Polyclonal Antibody (HRP)

SKU: orb2114378
This product can be custom made

Description

HSPA8 Rabbit Polyclonal Antibody (HRP) is an HRP conjugated, affinity purified antibody which is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the N terminal region of human HSPA8. This antibody is predicted to react with Equine, Goat, Human, Mouse, Rat, Yeast, Zebrafish. It is supplied as a liquid in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Research Area

Cell Biology

Images & Validation

−
HSPA8 Rabbit Polyclonal Antibody (HRP)
Tested ApplicationsIHC, WB
Predicted ReactivityEquine, Goat, Human, Mouse, Rat, Yeast, Zebrafish

Related Conjugates & Formulations

−
Unconjugated
Biotin
FITC

Key Properties

−
HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HSPA8
Protein SequenceSynthetic peptide located within the following region: VVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAAIAYGLDKKVGAE
Molecular Weight71kDa
PurificationAffinity Purified
ConjugationHRP

Storage & Handling

−
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

−
LAP1, HSC54, HSC70, HSC71, HSP71, HSP73, LAP-1, NIP71, HEL-33, HSPA10, HEL-S-72p
−

Quick Database Links

UniProt
P11142
RefSeq (Protein):NP_006588

UniProt Details

−
No UniProt data available

NCBI Reference Sequences

−
Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006588

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol