Peptidoglycan hydrolase

Referência NB-21-25429

Tamanho : 100ug

Marca : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Bacillus subtilis
Origin species:
Thermus phage TSP4
Uniprot ID:
A0A411CWC0 
Met1–Lys166 His

Specifications Peptidoglycan hydrolase

Product name Peptidoglycan hydrolase
Uniprot ID A0A411CWC0 
Origin species Thermus phage TSP4
Expression system Prokaryotic expression
Raw Antigen Sequence MRLPTKTSRFGYVHGQRNHEGIPHPGYDLNNGPTPTSDLGQPVYAPEDGVVVYARTGSGTWGGLVVVLGKSGFAHRLGHVRNIRVKEGQEVKEGQQVAEIGEFVKGLPHLHYDMVEPKVIHTISILIKAPYVRWDFWHVNFPKLFEHMYVDPARFHPELAKLLGGKGSHHHHHH
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Bacillus subtilis
Fragment Type Met1-Lys166
Reference PX-P4658
Note For research use only
Molecular Constructor
Met1–Lys166 His
Product name Peptidoglycan hydrolase
Uniprot ID A0A411CWC0 
Origin species Thermus phage TSP4
Expression system Prokaryotic expression
Raw Antigen Sequence MRLPTKTSRFGYVHGQRNHEGIPHPGYDLNNGPTPTSDLGQPVYAPEDGVVVYARTGSGTWGGLVVVLGKSGFAHRLGHVRNIRVKEGQEVKEGQQVAEIGEFVKGLPHLHYDMVEPKVIHTISILIKAPYVRWDFWHVNFPKLFEHMYVDPARFHPELAKLLGGKGSHHHHHH
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Bacillus subtilis
Fragment Type Met1-Lys166
Reference PX-P4658
Note For research use only
Molecular Constructor
Met1–Lys166 His

Documents

3D Representation

Peptidoglycan hydrolase

Reviews

There are no reviews yet.

Be the first to review “Peptidoglycan hydrolase” Cancel reply

Related products

  • PTX17851

    Anti His tag mouse monoclonal antibody