Reagentes e instrumentos para imunologia, biologia celular e biologia molecular.
 
> Recombinant Human DMC1 Protein, N-His

Recombinant Human DMC1 Protein, N-His

Imprimir Imprimir
Please log in

Referência NB-21-31934

Tamanho : 100µg

Marca : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q14565
Molecular weight:
37.41 kDa
Asp23–Glu340
Recombinant Human DMC1 Protein, N-His

Specifications Recombinant Human DMC1 Protein, N-His

Product name ARO-P11849-100
Uniprot ID Q14565
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
Molecular weight 37.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp23-Glu340
Aliases /Synonyms Meiotic recombination protein DMC1/LIM15 homolog, LIM15, DMC1, DMC1H
Reference ARO-P11849
Note For research use only.
Molecular Constructor
Asp23–Glu340
Product name ARO-P11849-1MG
Uniprot ID Q14565
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
Molecular weight 37.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp23-Glu340
Aliases /Synonyms Meiotic recombination protein DMC1/LIM15 homolog, LIM15, DMC1, DMC1H
Reference ARO-P11849
Note For research use only.
Molecular Constructor
Asp23–Glu340
Product name ARO-P11849-50
Uniprot ID Q14565
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DIDLLQKHGINVADIKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGAGGYPGGKIIFIDTENTFRPDRLRDIADRFNVDHDAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
Molecular weight 37.41 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp23-Glu340
Aliases /Synonyms Meiotic recombination protein DMC1/LIM15 homolog, LIM15, DMC1, DMC1H
Reference ARO-P11849
Note For research use only.
Molecular Constructor
Asp23–Glu340

Documents

3D Representation

Recombinant Human DMC1 Protein, N-His

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human DMC1 Protein, N-His” Cancel reply

Related products

  • Anti-Human DMC1 Polyclonal Antibody binds to Recombinant Human DMC1 Protein, N-His in WB Assay

    ARO-A12009

    Anti-Human DMC1 Polyclonal Antibody