Recombinant Human OVOL1 Protein, N-His

Referência NB-21-31974

Tamanho : 100µg

Marca : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
O14753
Molecular weight:
19.94 kDa
Asp116–Leu267

Specifications Recombinant Human OVOL1 Protein, N-His

Product name ARO-P11809-100
Uniprot ID O14753
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL
Molecular weight 19.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp116-Leu267
Aliases /Synonyms hOvo1, Putative transcription factor Ovo-like 1, OVOL1
Reference ARO-P11809
Note For research use only.
Molecular Constructor
Asp116–Leu267
Product name ARO-P11809-1MG
Uniprot ID O14753
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL
Molecular weight 19.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp116-Leu267
Aliases /Synonyms hOvo1, Putative transcription factor Ovo-like 1, OVOL1
Reference ARO-P11809
Note For research use only.
Molecular Constructor
Asp116–Leu267
Product name ARO-P11809-50
Uniprot ID O14753
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence DLFTCRVCQKAFTYQRMLNRHMKCHNDVKRHLCTYCGKGFNDTFDLKRHVRTHTGVRPYKCSLCDKAFTQRCSLESHLKKIHGVQQKYAYKERRAKLYVCEECGCTSESQEGHVLHLKEHHPDSPLLRKTSKKVAVALQNTVTSLLQGSPHL
Molecular weight 19.94 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asp116-Leu267
Aliases /Synonyms hOvo1, Putative transcription factor Ovo-like 1, OVOL1
Reference ARO-P11809
Note For research use only.
Molecular Constructor
Asp116–Leu267

Description

Introduction

Recombinant Human OVOL1 Protein, also known as OVO-like 1 protein, is a member of the zinc finger transcription factor family. It is encoded by the OVOL1 gene and is primarily expressed in the skin, lung, and stomach tissues. This protein plays a crucial role in regulating cell differentiation and proliferation, making it a promising target for various research and therapeutic applications.

Structure of Recombinant Human OVOL1 Protein

Recombinant Human OVOL1 Protein is a 384 amino acid protein with a molecular weight of approximately 43 kDa. It contains three C2H2-type zinc finger domains, which are crucial for its DNA-binding activity. These zinc finger domains are responsible for the specific recognition and binding of OVOL1 to target DNA sequences, thereby regulating the expression of target genes.

Activity of Recombinant Human OVOL1 Protein

Recombinant Human OVOL1 Protein plays a critical role in regulating cell differentiation and proliferation. It functions as a transcription factor, binding to specific DNA sequences and controlling the expression of target genes. OVOL1 has been shown to regulate the expression of various genes involved in cell adhesion, epithelial-mesenchymal transition, and cell cycle progression.

One of the key functions of OVOL1 is its role in maintaining the epithelial phenotype. It acts as a suppressor of epithelial-mesenchymal transition, a process where epithelial cells lose their characteristics and acquire a more migratory and invasive phenotype. OVOL1 achieves this by directly binding to the promoter regions of genes involved in epithelial-mesenchymal transition and inhibiting their expression.

In addition, OVOL1 also plays a role in regulating cell proliferation. It has been shown to suppress the expression of genes involved in cell cycle progression, thereby inhibiting cell proliferation. This function of OVOL1 is particularly important in the skin, where it helps maintain the balance between cell proliferation and differentiation, ensuring proper skin development and homeostasis.

Application of Recombinant Human OVOL1 Protein

Recombinant Human OVOL1 Protein has a wide range of applications in both research and therapeutic settings. Its role in regulating cell differentiation and proliferation makes it a valuable tool in studying various cellular processes and diseases.

In research, OVOL1 is commonly used as a recombinant protein for in vitro studies. Its DNA-binding activity allows for the identification of target genes and the study of their regulation. It is also used in cell culture experiments to study the effects of OVOL1 on cell proliferation and differentiation.

In therapeutic applications, OVOL1 has shown potential as a target for cancer treatment. Its role in suppressing epithelial-mesenchymal transition and cell proliferation makes it a promising candidate for inhibiting tumor growth and metastasis. Additionally, OVOL1 has been linked to various skin disorders, making it a potential target for the development of treatments for these conditions.

Conclusion

Recombinant Human OVOL1 Protein is a crucial player in regulating cell differentiation and proliferation. Its structure, activity, and various applications make it a valuable tool in both research and therapeutic settings. Further studies on OVOL1 and its role in various cellular processes and diseases may lead to the development of novel treatments for a wide range of conditions.

Documents

3D Representation

Recombinant Human OVOL1 Protein, N-His

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human OVOL1 Protein, N-His” Cancel reply

Related products

  • Anti-Human OVOL1 Polyclonal Antibody binds to Recombinant Human OVOL1 Protein, N-His in WB Assay

    ARO-A11975

    Anti-Human OVOL1 Polyclonal Antibody