Reagentes e instrumentos para imunologia, biologia celular e biologia molecular.
 
> Recombinant Human TEAD4 Protein, N-His

Recombinant Human TEAD4 Protein, N-His

Imprimir Imprimir
Please log in

Referência NB-21-32093

Tamanho : 100µg

Marca : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q15561
Molecular weight:
27.21 kDa
Ser222–Glu434
Recombinant Human TEAD4 Protein, N-His

Specifications Recombinant Human TEAD4 Protein, N-His

Product name ARO-P11690-100
Uniprot ID Q15561
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
Molecular weight 27.21 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser222-Glu434
Aliases /Synonyms TEAD4, Transcriptional enhancer factor TEF-3, TCF13L1, RTEF1, TEAD-4, Transcription factor 13-like 1, TEF3, Transcription factor RTEF-1, TEA domain family member 4
Reference ARO-P11690
Note For research use only.
Molecular Constructor
Ser222–Glu434
Product name ARO-P11690-1MG
Uniprot ID Q15561
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
Molecular weight 27.21 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser222-Glu434
Aliases /Synonyms TEAD4, Transcriptional enhancer factor TEF-3, TCF13L1, RTEF1, TEAD-4, Transcription factor 13-like 1, TEF3, Transcription factor RTEF-1, TEA domain family member 4
Reference ARO-P11690
Note For research use only.
Molecular Constructor
Ser222–Glu434
Product name ARO-P11690-50
Uniprot ID Q15561
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence SKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE
Molecular weight 27.21 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ser222-Glu434
Aliases /Synonyms TEAD4, Transcriptional enhancer factor TEF-3, TCF13L1, RTEF1, TEAD-4, Transcription factor 13-like 1, TEF3, Transcription factor RTEF-1, TEA domain family member 4
Reference ARO-P11690
Note For research use only.
Molecular Constructor
Ser222–Glu434

Documents

3D Representation

Recombinant Human TEAD4 Protein, N-His

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human TEAD4 Protein, N-His” Cancel reply

Related products

  • Anti-Human TEAD4 Polyclonal Antibody binds to Recombinant Human TEAD4 Protein, N-His in WB Assay

    ARO-A11880

    Anti-Human TEAD4 Polyclonal Antibody