SM22 alpha (TAGLN) (NM_001001522) Human Recombinant Protein

Referência TP302448

Tamanho : 20ug


SM22 alpha (TAGLN) (NM_001001522) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP302448
Recombinant protein of human transgelin (TAGLN), transcript variant 1, 20 µg
 
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202448 protein sequence
Red=Cloning site Green=Tags(s)

MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLY
PDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTK
NDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 22.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001001522
Locus ID 6876
UniProt ID Q01995
Cytogenetics 11q23.3
RefSeq Size 1574
RefSeq ORF 603
Synonyms SM22; SM22-alpha; SMCC; TAGLN1; WS3-10
Summary This gene encodes a shape change and transformation sensitive actin-binding protein which belongs to the calponin family. It is ubiquitously expressed in vascular and visceral smooth muscle, and is an early marker of smooth muscle differentiation. The encoded protein is thought to be involved in calcium-independent smooth muscle contraction. It acts as a tumor suppressor, and the loss of its expression is an early event in cell transformation and the development of some tumors, coinciding with cellular plasticity. The encoded protein has a domain architecture consisting of an N-terminal calponin homology (CH) domain and a C-terminal calponin-like (CLIK) domain. Mice with a knockout of the orthologous gene are viable and fertile but their vascular smooth muscle cells exhibit alterations in the distribution of the actin filament and changes in cytoskeletal organization. provided by RefSeq, Aug 2017
Protein Categories Intracellular Proteins
SKU Description Size
PH302448 TAGLN MS Standard C13 and N15-labeled recombinant protein (NP_001001522) 10 ug
PH315789 TAGLN MS Standard C13 and N15-labeled recombinant protein (NP_003177) 10 ug
LC401104 Lyophilized TAGLN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LC424369 Lyophilized TAGLN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
LY401104 Transient overexpression lysate of transgelin (TAGLN), transcript variant 2 (as WB positive control) 100 ug
LY424369 Transient overexpression lysate of transgelin (TAGLN), transcript variant 1 (as WB positive control) 100 ug
TP315789 Recombinant protein of human transgelin (TAGLN), transcript variant 2, 20 µg 20 ug

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products

Você também pode estar interessado nos seguintes produtos:



Referência
Descrição
Cond.
Price Bef. VAT