Acd antibody - C-terminal region

Referência ARP36813_P050

Tamanho : 100ul

Marca : Aviva Systems Biology

Contactar o distribuidor local :


Telefone : +1 850 650 7790

Datasheets/ManualsPrintable datasheet for anti-Acd (ARP36813_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the c terminal region of mouse Acd
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 83%; Dog: 85%; Guinea Pig: 85%; Horse: 85%; Human: 85%; Mouse: 100%; Rat: 93%
Peptide SequenceSynthetic peptide located within the following region: PRTSAQELCSVWEPPERHRDTSAFQYKYETPSASLHTQVQTARLSPQLVA
Concentration0.5 mg/ml
Blocking PeptideFor anti-Acd (ARP36813_P050) antibody is Catalog # AAP36813 (Previous Catalog # AAPP08687)
Gene SymbolAcd
Gene Full NameAdrenocortical dysplasia
Alias Symbols-
NCBI Gene Id497652
Protein NameAdrenocortical dysplasia protein
Description of TargetAcd is a component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways.Acd promotes binding of POT1 to single-stranded telomeric DNA.Acd modulates the inhibitory effects of POT1 on telomere elongation. The ACD-POT1 heterodimer enhances telomer elongation by increasing telomerase processivity.Acd plays a role in shelterin complex assembly. Acd may play an essential role in organogenesis of the developing embryo.
Uniprot IDQ5EE38
Protein Accession #NP_001012656
Nucleotide Accession #NM_001012638
Protein Size (# AA)416
Molecular Weight45
  1. What is the species homology for "Acd Antibody - C-terminal region (ARP36813_P050)"?

    The tested species reactivity for this item is "Mouse". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse".

  2. How long will it take to receive "Acd Antibody - C-terminal region (ARP36813_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "Acd Antibody - C-terminal region (ARP36813_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Acd Antibody - C-terminal region (ARP36813_P050)"?

    This target may also be called "-" in publications.

  5. What is the shipping cost for "Acd Antibody - C-terminal region (ARP36813_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "Acd Antibody - C-terminal region (ARP36813_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Acd Antibody - C-terminal region (ARP36813_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Acd Antibody - C-terminal region (ARP36813_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "ACD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "ACD"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "ACD"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "ACD"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "ACD"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "ACD"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.