Anti-Mouse LEFTY1 Polyclonal Antibody

Referência NB-21-39168

Tamanho : 100µg

Marca : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Clonality:
Polyclonal Antibody
Host species:
Rabbit

Specifications Anti-Mouse LEFTY1 Polyclonal Antibody

Product name ARO-A12836-100
Uniprot ID Q64280
Raw Antigen Sequence NLREVAGRFLVSETSTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRQKRLSPHSARARVTIEWLRFRDDGSNRTALIDSRLVSIHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSSHKLVRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCDPEAPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQLPESLTSRWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGALIPRRLQP
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Left-right determination factor B, Left-right determination factor 1, LEFTYB, LEFTY1, Protein lefty-1, LEFTB, Protein lefty-B,
Reference ARO-A12836
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Mouse LEFTY1 (Asn81-Pro368).
Product name ARO-A12836-1MG
Uniprot ID Q64280
Raw Antigen Sequence NLREVAGRFLVSETSTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRQKRLSPHSARARVTIEWLRFRDDGSNRTALIDSRLVSIHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSSHKLVRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCDPEAPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQLPESLTSRWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGALIPRRLQP
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Left-right determination factor B, Left-right determination factor 1, LEFTYB, LEFTY1, Protein lefty-1, LEFTB, Protein lefty-B,
Reference ARO-A12836
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Mouse LEFTY1 (Asn81-Pro368).
Product name ARO-A12836-50
Uniprot ID Q64280
Raw Antigen Sequence NLREVAGRFLVSETSTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPRTALRRQKRLSPHSARARVTIEWLRFRDDGSNRTALIDSRLVSIHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPGTWSSHKLVRFAAQGTPDGKGQGEPQLELHTLDLKDYGAQGNCDPEAPVTEGTRCCRQEMYLDLQGMKWAENWILEPPGFLTYECVGSCLQLPESLTSRWPFLGPRQCVASEMTSLPMIVSVKEGGRTRPQVVSLPNMRVQTCSCASDGALIPRRLQP
Buffer 0.01M PBS, pH 7.4, 50% glycerol, 0.05% Proclin 300.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Use a manual defrost freezer and avoid repeated freeze thaw cycles.Store at 4°C for frequent use.Store at -20 to -80 °C for twelve months from the date of receipt.
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Left-right determination factor B, Left-right determination factor 1, LEFTYB, LEFTY1, Protein lefty-1, LEFTB, Protein lefty-B,
Reference ARO-A12836
Clonality Polyclonal Antibody
Protein Name E. coli - derived recombinant Mouse LEFTY1 (Asn81-Pro368).

Documents

Reviews

There are no reviews yet.

Be the first to review “Anti-Mouse LEFTY1 Polyclonal Antibody” Cancel reply

Related products

  • Anti-LEFTY1 Polyclonal antibody binds to Recombinant Mouse LEFTY1 Protein, N-His in WB Assay

    ARO-A14313

    Anti-LEFTY1 Polyclonal antibody