CD239 (BCAM) Rabbit Polyclonal Antibody

Referência TA342884

Tamanho : 100ul


CD239 (BCAM) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA342884
Rabbit Polyclonal Anti-BCAM Antibody
 
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-BCAM antibody: synthetic peptide directed towards the C terminal of human BCAM. Synthetic peptide located within the following region: ADGSWREGDEVTLICSARGHPDPKLSWSQLGGSPAEPIPGRQGWVSSSLT
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 64 kDa
Gene Name basal cell adhesion molecule (Lutheran blood group)
Database Link
Background Lutheran blood group glycoprotein is a member of the immunoglobulin superfamily and a receptor for the extracellular matrix protein, laminin. This protein may play a role in epithelial cell cancer and in vaso-occlusion of red blood cells in sickle cell disease.
Synonyms AU; CD239; LU; MSK19
Note Immunogen Sequence Homology: Human: 100%; Dog: 86%; Rabbit: 86%; Horse: 85%; Pig: 83%; Rat: 79%; Mouse: 79%; Bovine
Reference Data
Protein Categories CD Markers, Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products

Você também pode estar interessado nos seguintes produtos:



Referência
Descrição
Cond.
Price Bef. VAT