GRXCR2 Antibody - C-terminal region

Referência ARP70509_P050-25UL

Tamanho : 25ul

Marca : Aviva Systems Biology


GRXCR2 Antibody - C-terminal region (ARP70509_P050)

Datasheets/ManualsPrintable datasheet for anti-GRXCR2 (ARP70509_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human GRXCR2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: PLVEAESTLPQNRYTQEGDIPEDSCFHCRGSGSATCSLCHGSKFSMLANR
Concentration0.5 mg/ml
Blocking PeptideFor anti-GRXCR2 (ARP70509_P050) antibody is Catalog # AAP70509
Gene SymbolGRXCR2
Alias SymbolsDFNB101
NCBI Gene Id643226
Protein NameGlutaredoxin domain-containing cysteine-rich protein 2
Description of TargetThe function of this protein remains unknown.
Uniprot IDA6NFK2
Protein Accession #NP_001073985
Nucleotide Accession #NM_001080516
Protein Size (# AA)248
Molecular Weight28kDa

Você também pode estar interessado nos seguintes produtos:



Referência
Descrição
Cond.
Price Bef. VAT
ARP48303_P050-25UL
 25ul 
ARP60282_P050-25UL
 25ul