Human IGFBP1 Nter Recombinant Protein

Referência NB-21-24765

Tamanho : 50ug

Marca : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P08833
Molecular weight:
17.59 kD
Partial

Specifications Human IGFBP1 Nter Recombinant Protein

Product name Human IGFBP1 Nter Recombinant Protein
Uniprot ID P08833
Uniprot link http://www.uniprot.org/uniprot/P08833
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKLEHHHHHH
Molecular weight 17.59 kD
Purity estimated 85%
Buffer PBS, pH 7.5 with 0.2mM β-Met
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession ACO37638.1
Spec:Entrez GeneID 3484
Spec:NCBI Gene Aliases hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25
Spec:SwissProtID P08833
NCBI Reference ACO37638.1
Aliases /Synonyms IGFBP1 Nter, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1
Reference PX-P2078
Note For research use only
Molecular Constructor
Partial
Product name Human IGFBP1 Nter Recombinant Protein
Uniprot ID P08833
Uniprot link http://www.uniprot.org/uniprot/P08833
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKLEHHHHHH
Molecular weight 17.59 kD
Purity estimated 85%
Buffer PBS, pH 7.5 with 0.2mM β-Met
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession ACO37638.1
Spec:Entrez GeneID 3484
Spec:NCBI Gene Aliases hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25
Spec:SwissProtID P08833
NCBI Reference ACO37638.1
Aliases /Synonyms IGFBP1 Nter, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1
Reference PX-P2078
Note For research use only
Molecular Constructor
Partial
Product name PX-P2078-1MG
Uniprot ID P08833
Uniprot link http://www.uniprot.org/uniprot/P08833
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Raw Antigen Sequence MKYLLPTAAAGLLLLAAQPAMA^MDAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCCPMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKLEHHHHHH
Molecular weight 17.59 kD
Purity estimated 85%
Buffer PBS, pH 7.5 with 0.2mM β-Met
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Protein Accession ACO37638.1
Spec:Entrez GeneID 3484
Spec:NCBI Gene Aliases hIGFBP-1, AFBP, IBP1, PP12, IGF-BP25
Spec:SwissProtID P08833
NCBI Reference ACO37638.1
Aliases /Synonyms IGFBP1 Nter, insulin-like Growth Factor proteins binding protein 1, Insulin-like Growth Factor proteins-binding protein 1
Reference PX-P2078
Note For research use only
Molecular Constructor
Partial

Documents

3D Representation

Human IGFBP1 Nter Recombinant Protein

Reviews

There are no reviews yet.

Be the first to review “Human IGFBP1 Nter Recombinant Protein” Cancel reply

Related products

  • Tucotuzumab Biosimilar - Anti-EPCAM, CD326 mAb - Research Grade in ELISA Assay

    PX-TA1182

    Tucotuzumab Biosimilar – Anti-EPCAM, CD326 mAb – Research Grade