Tamanho : 100ug
| Product name | Inhibin beta B chain(INHBB) |
|---|---|
| Uniprot ID | P09529 |
| Origin species | Homo sapiens (Human) |
| Expression system | Eukaryotic expression |
| Raw Antigen Sequence | GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90%by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Host species | Mammalian cells |
| Fragment Type | Gly293-Ala407 |
| Aliases /Synonyms | Activin beta-B chain |
| Reference | PX-P4647 |
| Note | For research use only |
| Molecular Constructor | Gly293–Ala407 His |