Reagentes e instrumentos para imunologia, biologia celular e biologia molecular.
 
> RBPJL Peptide - middle region

RBPJL Peptide - middle region

Imprimir Imprimir
Please log in

Referência orb2003119-100ug

Tamanho : 100ug

Marca : Biorbyt


RBPJL Peptide - middle region

SKU: orb2003119
This product can be custom made

Description

RBPJL Peptide - middle region, also known as RBPJL,RBPL, RBPSUHL,, is a synthetic peptide designed for use in combination with RBPJL Rabbit Polyclonal Antibody (orb588012). It corresponds to the sequence GAFVASARQWAAFTLHLADGHSAQGDFPPREGYVRYGSLVQLVCTVTGIT and is supplied in a lyophilized powder. This peptide is for research use only.

Images & Validation

−
RBPJL Peptide - middle region
Tested ApplicationsWB
Application Notes
This is a synthetic peptide designed for use in combination with RBPJL Rabbit Polyclonal Antibody (orb588012). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Key Properties

−
Protein SequenceSynthetic peptide located within the following region: GAFVASARQWAAFTLHLADGHSAQGDFPPREGYVRYGSLVQLVCTVTGIT

Storage & Handling

−
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

−
RBPJL,RBPL, RBPSUHL,
−

Quick Database Links

UniProt
Q9UBG7

UniProt Details

−
Loading UniProt data...

Protocol Information

Protein Handling and Storage Guide
Protein Handling Guide
View Guide
WB
Western Blot (IB, immunoblot)
View Protocol