Recombinant Human RAD51, N-His

Referência NB-21-29606

Tamanho : 100µg

Marca : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
Q06609
Molecular weight:
20.42 kDa
Val174–Asp339

Specifications Recombinant Human RAD51, N-His

Product name ARO-P13487-100
Uniprot ID Q06609
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
Molecular weight 20.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val174-Asp339
Aliases /Synonyms HsRAD51, RAD51A, RECA, hRAD51, RAD51, RAD51 homolog A, DNA repair protein RAD51 homolog 1
Reference ARO-P13487
Note For research use only.
Molecular Constructor
Val174–Asp339
Product name ARO-P13487-1MG
Uniprot ID Q06609
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
Molecular weight 20.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val174-Asp339
Aliases /Synonyms HsRAD51, RAD51A, RECA, hRAD51, RAD51, RAD51 homolog A, DNA repair protein RAD51 homolog 1
Reference ARO-P13487
Note For research use only.
Molecular Constructor
Val174–Asp339
Product name ARO-P13487-50
Uniprot ID Q06609
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence VAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
Molecular weight 20.42 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Val174-Asp339
Aliases /Synonyms HsRAD51, RAD51A, RECA, hRAD51, RAD51, RAD51 homolog A, DNA repair protein RAD51 homolog 1
Reference ARO-P13487
Note For research use only.
Molecular Constructor
Val174–Asp339

Documents

3D Representation

Recombinant Human RAD51, N-His

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human RAD51, N-His” Cancel reply

Related products

  • Anti-RAD51 Polyclonal antibody binds to Recombinant Human RAD51, N-His in WB Assay

    ARO-A13850

    Anti-RAD51 Polyclonal antibody