Recombinant Human HLA-G Protein, N-GST
Référence NB-21-28812
Conditionnement : 100µg
Conditionnement : 100µg
| Product name | ARO-P14768-100 |
|---|---|
| Uniprot ID | P17693 |
| Origin species | Human |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | MRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSH |
| Molecular weight | 37.24 kDa |
| Protein delivered with Tag? | N-Terminal GST Tag |
| Buffer | Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol. |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 3-5 days if in stock; 3-5 weeks if production needed |
| Storage condition | 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Met29-His117 |
| Aliases /Synonyms | HLAG, HLA-G, sHLA-G, HLA G antigen, MHC class I antigen G, HLA-6.0, HLA class I histocompatibility antigen, alpha chain G |
| Reference | ARO-P14768 |
| Note | For research use only. |
| Molecular Constructor | GST Met29–His117 |