Recombinant Human KCNH2/ERG1 Protein, N-His-SUMO

Specifications Recombinant Human KCNH2/ERG1 Protein, N-His-SUMO

Product name	ARO-P11306-100
Uniprot ID	Q12809
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	PQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
Molecular weight	26.62 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Pro10-Lys135
Aliases /Synonyms	H-ERG, ERG, HERG, hERG1, hERG-1, Potassium voltage-gated channel subfamily H member 2, ERG-1, KCNH2, Eag homolog, ERG1, Eag-related protein 1, Ether-a-go-go-related gene potassium channel 1, Voltage-gated potassium channel subunit Kv11.1, Ether-a-go-go-related protein 1
Reference	ARO-P11306
Note	For research use only.
Molecular Constructor	Pro10–Lys135

Product name	ARO-P11306-1MG
Uniprot ID	Q12809
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	PQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
Molecular weight	26.62 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Pro10-Lys135
Aliases /Synonyms	H-ERG, ERG, HERG, hERG1, hERG-1, Potassium voltage-gated channel subfamily H member 2, ERG-1, KCNH2, Eag homolog, ERG1, Eag-related protein 1, Ether-a-go-go-related gene potassium channel 1, Voltage-gated potassium channel subunit Kv11.1, Ether-a-go-go-related protein 1
Reference	ARO-P11306
Note	For research use only.
Molecular Constructor	Pro10–Lys135

Product name	ARO-P11306-50
Uniprot ID	Q12809
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	PQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVMQRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK
Molecular weight	26.62 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Pro10-Lys135
Aliases /Synonyms	H-ERG, ERG, HERG, hERG1, hERG-1, Potassium voltage-gated channel subfamily H member 2, ERG-1, KCNH2, Eag homolog, ERG1, Eag-related protein 1, Ether-a-go-go-related gene potassium channel 1, Voltage-gated potassium channel subunit Kv11.1, Ether-a-go-go-related protein 1
Reference	ARO-P11306
Note	For research use only.
Molecular Constructor	Pro10–Lys135

Documents

• Datasheet

3D Representation

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human KCNH2/ERG1 Protein, N-His-SUMO” Cancel reply